Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Riftia pachyptila [TaxId:6426] [254981] (1 PDB entry) |
Domain d1yhuv_: 1yhu V: [241029] automated match to d1x9fc_ complexed with hem, oxy, zn |
PDB Entry: 1yhu (more details), 3.15 Å
SCOPe Domain Sequences for d1yhuv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yhuv_ a.1.1.0 (V:) automated matches {Riftia pachyptila [TaxId: 6426]} dyvcgplqrlkvkrqwaeaygsgnsreefghfiwshvfqhspaardmfkrvrgdnihtpa frahatrvlggldmciallddepvlntqlahlakqhetrgveaahydtvnhavmmgvenv igsevfdqdawkpclnvitngiqg
Timeline for d1yhuv_: