![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
![]() | Protein automated matches [190590] (26 species) not a true protein |
![]() | Species Riftia pachyptila [TaxId:6426] [254981] (1 PDB entry) |
![]() | Domain d1yhuj_: 1yhu J: [241020] automated match to d1x9fc_ complexed with hem, oxy, zn |
PDB Entry: 1yhu (more details), 3.15 Å
SCOPe Domain Sequences for d1yhuj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yhuj_ a.1.1.0 (J:) automated matches {Riftia pachyptila [TaxId: 6426]} dyvcgplqrlkvkrqwaeaygsgnsreefghfiwshvfqhspaardmfkrvrgdnihtpa frahatrvlggldmciallddepvlntqlahlakqhetrgveaahydtvnhavmmgvenv igsevfdqdawkpclnvitngiqg
Timeline for d1yhuj_: