SCOPe 2.01: Domain d1sbfa_: 1sbf A:

Lineage for d1sbfa_ (1sbf A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Soybean (Glycine max) [TaxId:3847] [49913] (5 PDB entries)

8. Domain d1sbfa_: 1sbf A: [24102]
   complexed with ca, gal, mn, nag

Details for d1sbfa_

PDB Entry: 1sbf, 2.43 Å

PDB Description: soybean agglutinin

PDB Compounds: (A:) soybean agglutinin

SCOPe Domain Sequences for d1sbfa_:

Sequence; same for both SEQRES and ATOM records:

>d1sbfa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]}
aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqv
vavefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslv
ypsqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlph

Timeline for d1sbfa_:

• d1sbfa_ first appeared (with stable ids) in SCOP 1.55, called d1sbf__
  
• d1sbfa_ appears in SCOP 1.75
  
• d1sbfa_ appears in SCOPe 2.02
  
• d1sbfa_ appears in the current release, SCOPe 2.08