Lineage for d1sbf__ (1sbf -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12628Species Soybean (Glycine max) [TaxId:3847] [49913] (4 PDB entries)
  8. 12629Domain d1sbf__: 1sbf - [24102]

Details for d1sbf__

PDB Entry: 1sbf (more details), 2.42 Å

PDB Description: soybean agglutinin

SCOP Domain Sequences for d1sbf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbf__ b.29.1.1 (-) Lectin {Soybean (Glycine max)}
aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqv
vavefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslv
ypsqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlph

SCOP Domain Coordinates for d1sbf__:

Click to download the PDB-style file with coordinates for d1sbf__.
(The format of our PDB-style files is described here.)

Timeline for d1sbf__: