Lineage for d1yhue_ (1yhu E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689546Species Riftia pachyptila [TaxId:6426] [254981] (1 PDB entry)
  8. 2689550Domain d1yhue_: 1yhu E: [241016]
    automated match to d1x9fb_
    complexed with hem, oxy, zn

Details for d1yhue_

PDB Entry: 1yhu (more details), 3.15 Å

PDB Description: Crystal structure of Riftia pachyptila C1 hemoglobin reveals novel assembly of 24 subunits.
PDB Compounds: (E:) hemoglobin A1 chain

SCOPe Domain Sequences for d1yhue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhue_ a.1.1.0 (E:) automated matches {Riftia pachyptila [TaxId: 6426]}
acamlerakvkdewakaygigaarskfgdalwrnvfnyapnardifesvnskdmaspefk
ahiarvlggldrvismldnqatldadlahlksqhdprtidpvnfvvfrkaliatvagtfg
vcfdvpawqgcyniiakgitgsdaa

SCOPe Domain Coordinates for d1yhue_:

Click to download the PDB-style file with coordinates for d1yhue_.
(The format of our PDB-style files is described here.)

Timeline for d1yhue_: