SCOPe 2.06: Domain d1yhda1: 1yhd A:3-92

Lineage for d1yhda1 (1yhd A:3-92)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.279: YggX-like [111147] (1 superfamily)
   beta(2)-alpha(3); contains zinc-less 'zinc finger'-like fold (57715)

4. Superfamily d.279.1: YggX-like [111148] (2 families)
   automatically mapped to Pfam PF04362

5. Family d.279.1.1: YggX-like [111149] (2 proteins)
   Pfam PF04362

6. Protein Hypothetical protein YggX [118087] (2 species)

7. Species Escherichia coli [TaxId:562] [254980] (1 PDB entry)

8. Domain d1yhda1: 1yhd A:3-92 [241012]
   Other proteins in same PDB: d1yhda2
   automated match to d1xs8a_

Details for d1yhda1

PDB Entry: 1yhd

PDB Description: the solution structure of yggx from escherichia coli

PDB Compounds: (A:) UPF0269 protein yggX

SCOPe Domain Sequences for d1yhda1:

Sequence; same for both SEQRES and ATOM records:

>d1yhda1 d.279.1.1 (A:3-92) Hypothetical protein YggX {Escherichia coli [TaxId: 562]}
srtifctflqreaegqdfqlypgelgkriyneiskeawaqwqhkqtmlinekklnmmnae
hrklleqemvnflfegkevhiegytpedkk

Timeline for d1yhda1:

• d1yhda1 first appeared in SCOPe 2.04, called d1yhda_
  
• d1yhda1 was called d1yhda_ in SCOPe 2.05
  
• d1yhda1 appears in SCOPe 2.07
  
• d1yhda1 appears in the current release, SCOPe 2.08