SCOPe 2.05: Domain d1yhda_: 1yhd A:

Lineage for d1yhda_ (1yhd A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.279: YggX-like [111147] (1 superfamily)
   beta(2)-alpha(3); contains zinc-less 'zinc finger'-like fold (57715)

4. Superfamily d.279.1: YggX-like [111148] (2 families)
   automatically mapped to Pfam PF04362

5. Family d.279.1.1: YggX-like [111149] (2 proteins)
   Pfam PF04362

6. Protein Hypothetical protein YggX [118087] (2 species)

7. Species Escherichia coli [TaxId:562] [254980] (1 PDB entry)

8. Domain d1yhda_: 1yhd A: [241012]
   automated match to d1xs8a_

Details for d1yhda_

PDB Entry: 1yhd

PDB Description: the solution structure of yggx from escherichia coli

PDB Compounds: (A:) UPF0269 protein yggX

SCOPe Domain Sequences for d1yhda_:

Sequence; same for both SEQRES and ATOM records:

>d1yhda_ d.279.1.1 (A:) Hypothetical protein YggX {Escherichia coli [TaxId: 562]}
mgsrtifctflqreaegqdfqlypgelgkriyneiskeawaqwqhkqtmlinekklnmmn
aehrklleqemvnflfegkevhiegytpedkk

Timeline for d1yhda_:

• d1yhda_ first appeared in SCOPe 2.04
  
• d1yhda_ is called d1yhda1 in SCOPe 2.06
  
• d1yhda_ appears in the current release, SCOPe 2.08, called d1yhda1