Lineage for d1yhda_ (1yhd A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688219Fold d.279: YggX-like [111147] (1 superfamily)
    beta(2)-alpha(3); contains zinc-less 'zinc finger'-like fold (57715)
  4. 1688220Superfamily d.279.1: YggX-like [111148] (1 family) (S)
    automatically mapped to Pfam PF04362
  5. 1688221Family d.279.1.1: YggX-like [111149] (2 proteins)
    Pfam PF04362
  6. 1688225Protein Hypothetical protein YggX [118087] (2 species)
  7. 1688226Species Escherichia coli [TaxId:562] [254980] (1 PDB entry)
  8. 1688227Domain d1yhda_: 1yhd A: [241012]
    automated match to d1xs8a_

Details for d1yhda_

PDB Entry: 1yhd (more details)

PDB Description: The solution structure of YGGX from Escherichia Coli
PDB Compounds: (A:) UPF0269 protein yggX

SCOPe Domain Sequences for d1yhda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhda_ d.279.1.1 (A:) Hypothetical protein YggX {Escherichia coli [TaxId: 562]}
mgsrtifctflqreaegqdfqlypgelgkriyneiskeawaqwqhkqtmlinekklnmmn
aehrklleqemvnflfegkevhiegytpedkk

SCOPe Domain Coordinates for d1yhda_:

Click to download the PDB-style file with coordinates for d1yhda_.
(The format of our PDB-style files is described here.)

Timeline for d1yhda_: