Lineage for d1yhda1 (1yhd A:3-92)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2566024Fold d.279: YggX-like [111147] (1 superfamily)
    beta(2)-alpha(3); contains zinc-less 'zinc finger'-like fold (57715)
  4. 2566025Superfamily d.279.1: YggX-like [111148] (2 families) (S)
    automatically mapped to Pfam PF04362
  5. 2566026Family d.279.1.1: YggX-like [111149] (2 proteins)
    Pfam PF04362
  6. 2566030Protein Hypothetical protein YggX [118087] (2 species)
  7. 2566031Species Escherichia coli [TaxId:562] [254980] (1 PDB entry)
  8. 2566032Domain d1yhda1: 1yhd A:3-92 [241012]
    Other proteins in same PDB: d1yhda2
    automated match to d1xs8a_

Details for d1yhda1

PDB Entry: 1yhd (more details)

PDB Description: The solution structure of YGGX from Escherichia Coli
PDB Compounds: (A:) UPF0269 protein yggX

SCOPe Domain Sequences for d1yhda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhda1 d.279.1.1 (A:3-92) Hypothetical protein YggX {Escherichia coli [TaxId: 562]}
srtifctflqreaegqdfqlypgelgkriyneiskeawaqwqhkqtmlinekklnmmnae
hrklleqemvnflfegkevhiegytpedkk

SCOPe Domain Coordinates for d1yhda1:

Click to download the PDB-style file with coordinates for d1yhda1.
(The format of our PDB-style files is described here.)

Timeline for d1yhda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yhda2