Lineage for d1yc9a_ (1yc9 A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.5: Outer membrane efflux proteins (OEP) [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. Superfamily f.5.1: Outer membrane efflux proteins (OEP) [56954] (2 families) (S)
  5. Family f.5.1.0: automated matches [227266] (1 protein)
    not a true family
  6. Protein automated matches [227059] (5 species)
    not a true protein
  7. Species Vibrio cholerae [TaxId:666] [254977] (1 PDB entry)
  8. Domain d1yc9a_: 1yc9 A: [241011]
    automated match to d4k7ka_
    complexed with bog, hg

Details for d1yc9a_

PDB Entry: 1yc9 (more details), 1.8 Å

PDB Description: the crystal structure of the outer membrane protein vcec from the bacterial pathogen vibrio cholerae at 1.8 resolution
PDB Compounds: (A:) multidrug resistance protein

SCOPe Domain Sequences for d1yc9a_:

Sequence, based on SEQRES records: (download)

>d1yc9a_ f.5.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
wpsanwwqryqdaqlnhlieealqhspslcmamarlkgaqgfarqagairsfdlglaasa
teskvseryqsatppdgwndygtltlnfqydfdfwgknraavvaatselaaaeaesvaar
lmistsianayaelarlyanqetvhaalqvrnktvellekryangletlgsvsqakavaa
sveaellgiqesiqlqknalaalvgqgpdraasieephitltsryglpseagvgllghra
ditaarwraeaaaqqvgiaqaqfypdvtlsafigyqafgldhlfdsgndagaigpaiylp
lftggrlegqltsaearyqeavaqyngtlvqalheiadvvtssqalqarinkteqavqqa
eqalhiatnryqgglatyldvlvaeesllnnqralvnlqsrafsldlalihalgggfe

Sequence, based on observed residues (ATOM records): (download)

>d1yc9a_ f.5.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
wpsanwwqryqdaqlnhlieealqhspslcmamarlkgaqgfarqagairsfdlglaasa
teskvseryqsatppdgwndygtltlnfqydfdfwgknraavvaatselaaaeaesvaar
lmistsianayaelarlyanqetvhaalqvrnktvellekryangletlgsvsqakavaa
sveaellgiqesiqlqknalaalvgqgpdraasieephitltsryvgllghraditaarw
raeaaaqqvgiaqaqfypdvtlsafigyqafgldhlfdsgndagaigpaiylplftggrl
egqltsaearyqeavaqyngtlvqalheiadvvtssqalqarinkteqavqqaeqalhia
tnryqgglatyldvlvaeesllnnqralvnlqsrafsldlalihalgggfe

SCOPe Domain Coordinates for d1yc9a_ are not available.

Timeline for d1yc9a_: