SCOP 1.75: Domain d1bzwd_: 1bzw D:

Lineage for d1bzwd_ (1bzw D:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)
   Uniprot P02872 24-255

8. Domain d1bzwd_: 1bzw D: [24101]
   complexed with gal, glc, kal, mn

Details for d1bzwd_

PDB Entry: 1bzw, 2.7 Å

PDB Description: peanut lectin complexed with c-lactose

PDB Compounds: (D:) protein (peanut lectin)

SCOP Domain Sequences for d1bzwd_:

Sequence; same for both SEQRES and ATOM records:

>d1bzwd_ b.29.1.1 (D:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

Timeline for d1bzwd_:

• d1bzwd_ first appeared (with stable ids) in SCOP 1.55
  
• d1bzwd_ appears in SCOP 1.73
  
• d1bzwd_ appears in SCOPe 2.01
  
• d1bzwd_ appears in the current release, SCOPe 2.08