Lineage for d1bzwd_ (1bzw D:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226529Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 226650Protein Legume lectin [49904] (22 species)
  7. 226792Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (7 PDB entries)
  8. 226804Domain d1bzwd_: 1bzw D: [24101]
    complexed with gal, glc, kal, mn

Details for d1bzwd_

PDB Entry: 1bzw (more details), 2.7 Å

PDB Description: peanut lectin complexed with c-lactose

SCOP Domain Sequences for d1bzwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzwd_ b.29.1.1 (D:) Legume lectin {Peanut (Arachis hypogaea)}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d1bzwd_:

Click to download the PDB-style file with coordinates for d1bzwd_.
(The format of our PDB-style files is described here.)

Timeline for d1bzwd_: