Lineage for d1ybib2 (1ybi B:152-293)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385272Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2385504Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2385505Protein automated matches [226913] (9 species)
    not a true protein
  7. 2385528Species Clostridium botulinum [TaxId:1491] [254975] (8 PDB entries)
  8. 2385532Domain d1ybib2: 1ybi B:152-293 [241004]
    automated match to d2e4ma2

Details for d1ybib2

PDB Entry: 1ybi (more details), 1.5 Å

PDB Description: Crystal structure of HA33A, a neurotoxin-associated protein from Clostridium botulinum type A
PDB Compounds: (B:) non-toxin haemagglutinin HA34

SCOPe Domain Sequences for d1ybib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybib2 b.42.2.0 (B:152-293) automated matches {Clostridium botulinum [TaxId: 1491]}
nftckispildlnkvvqqvdvtnlnvnlytwdygrnqkwtiryneekaayqffntilsng
vltwifsngntvrvsssndqnndaqywlinpvsdtdetytitnlrdttkaldlyggqtan
gtaiqvfnyhgddnqkwnirnp

SCOPe Domain Coordinates for d1ybib2:

Click to download the PDB-style file with coordinates for d1ybib2.
(The format of our PDB-style files is described here.)

Timeline for d1ybib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ybib1