Lineage for d1ybib1 (1ybi B:10-151)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543418Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1543626Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 1543627Protein automated matches [226913] (8 species)
    not a true protein
  7. 1543631Species Clostridium botulinum [TaxId:1491] [254975] (6 PDB entries)
  8. 1543634Domain d1ybib1: 1ybi B:10-151 [241003]
    automated match to d2e4ma1

Details for d1ybib1

PDB Entry: 1ybi (more details), 1.5 Å

PDB Description: Crystal structure of HA33A, a neurotoxin-associated protein from Clostridium botulinum type A
PDB Compounds: (B:) non-toxin haemagglutinin HA34

SCOPe Domain Sequences for d1ybib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybib1 b.42.2.0 (B:10-151) automated matches {Clostridium botulinum [TaxId: 1491]}
slndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihnt
nlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlkl
stlnnsnyikfiiedyiisdln

SCOPe Domain Coordinates for d1ybib1:

Click to download the PDB-style file with coordinates for d1ybib1.
(The format of our PDB-style files is described here.)

Timeline for d1ybib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ybib2