Lineage for d1bzwc_ (1bzw C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 294478Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 294600Protein Legume lectin [49904] (22 species)
  7. 294746Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (7 PDB entries)
  8. 294773Domain d1bzwc_: 1bzw C: [24100]

Details for d1bzwc_

PDB Entry: 1bzw (more details), 2.7 Å

PDB Description: peanut lectin complexed with c-lactose

SCOP Domain Sequences for d1bzwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzwc_ b.29.1.1 (C:) Legume lectin {Peanut (Arachis hypogaea)}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d1bzwc_:

Click to download the PDB-style file with coordinates for d1bzwc_.
(The format of our PDB-style files is described here.)

Timeline for d1bzwc_: