Lineage for d1y9xb_ (1y9x B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199715Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2200050Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2200051Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)
  6. 2200070Protein automated matches [190221] (4 species)
    not a true protein
  7. 2200079Species Sulfolobus shibatae [TaxId:2286] [229739] (2 PDB entries)
  8. 2200085Domain d1y9xb_: 1y9x B: [240996]
    automated match to d3wbma_

Details for d1y9xb_

PDB Entry: 1y9x (more details)

PDB Description: solution structure of archaeon dna-binding protein ssh10b
PDB Compounds: (B:) DNA/RNA-binding protein alba 1

SCOPe Domain Sequences for d1y9xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9xb_ d.68.6.1 (B:) automated matches {Sulfolobus shibatae [TaxId: 2286]}
mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
ladkieikeirvgsqvvtsqdgrqsrvstieiairkk

SCOPe Domain Coordinates for d1y9xb_:

Click to download the PDB-style file with coordinates for d1y9xb_.
(The format of our PDB-style files is described here.)

Timeline for d1y9xb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y9xa_