SCOPe 2.08: Domain d1y9xb_: 1y9x B:

Lineage for d1y9xb_ (1y9x B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: AlbA-like [82704] (3 families)

5. Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)

6. Protein automated matches [190221] (4 species)
   not a true protein

7. Species Sulfolobus shibatae [TaxId:2286] [229739] (2 PDB entries)

8. Domain d1y9xb_: 1y9x B: [240996]
   automated match to d3wbma_

Details for d1y9xb_

PDB Entry: 1y9x

PDB Description: solution structure of archaeon dna-binding protein ssh10b

PDB Compounds: (B:) DNA/RNA-binding protein alba 1

SCOPe Domain Sequences for d1y9xb_:

Sequence; same for both SEQRES and ATOM records:

>d1y9xb_ d.68.6.1 (B:) automated matches {Sulfolobus shibatae [TaxId: 2286]}
mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
ladkieikeirvgsqvvtsqdgrqsrvstieiairkk

Timeline for d1y9xb_:

• d1y9xb_ first appeared in SCOPe 2.04
  
• d1y9xb_ appears in SCOPe 2.07