| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.6: AlbA-like [82704] (3 families) ![]() |
| Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins) |
| Protein automated matches [190221] (4 species) not a true protein |
| Species Sulfolobus shibatae [TaxId:2286] [229739] (2 PDB entries) |
| Domain d1y9xa_: 1y9x A: [240995] automated match to d3wbma_ |
PDB Entry: 1y9x (more details)
SCOPe Domain Sequences for d1y9xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y9xa_ d.68.6.1 (A:) automated matches {Sulfolobus shibatae [TaxId: 2286]}
mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
ladkieikeirvgsqvvtsqdgrqsrvstieiairkk
Timeline for d1y9xa_: