SCOPe 2.05: Domain d1y9oa_: 1y9o A:

Lineage for d1y9oa_ (1y9o A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families)

5. Family d.58.10.0: automated matches [191394] (1 protein)
   not a true family

6. Protein automated matches [190511] (7 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [187465] (8 PDB entries)

8. Domain d1y9oa_: 1y9o A: [240994]
   automated match to d2bjda_

Details for d1y9oa_

PDB Entry: 1y9o

PDB Description: 1h nmr structure of acylphosphatase from the hyperthermophile sulfolobus solfataricus

PDB Compounds: (A:) acylphosphatase

SCOPe Domain Sequences for d1y9oa_:

Sequence; same for both SEQRES and ATOM records:

>d1y9oa_ d.58.10.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
gsmkkwsdtevfemlkrmyarvyglvqgvgfrkfvqihairlgikgyaknlpdgsvevva
egyeealskllerikqgppaaevekvdysfseykgefedfety

Timeline for d1y9oa_:

• d1y9oa_ first appeared in SCOPe 2.04
  
• d1y9oa_ is called d1y9oa1 in SCOPe 2.06
  
• d1y9oa_ appears in the current release, SCOPe 2.08, called d1y9oa1