Lineage for d1y9dd2 (1y9d D:183-365)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2470886Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2471085Protein Pyruvate oxidase [52476] (2 species)
    binds FAD
  7. 2471089Species Lactobacillus plantarum [TaxId:1590] [52477] (8 PDB entries)
  8. 2471097Domain d1y9dd2: 1y9d D:183-365 [240992]
    Other proteins in same PDB: d1y9da1, d1y9da3, d1y9db1, d1y9db3, d1y9dc1, d1y9dc3, d1y9dd1, d1y9dd3
    automated match to d2ez9a1
    complexed with fad, mg, na, so4, tpp

Details for d1y9dd2

PDB Entry: 1y9d (more details), 2.2 Å

PDB Description: pyruvate oxidase variant v265a from lactobacillus plantarum
PDB Compounds: (D:) Pyruvate oxidase

SCOPe Domain Sequences for d1y9dd2:

Sequence, based on SEQRES records: (download)

>d1y9dd2 c.31.1.3 (D:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanraaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led

Sequence, based on observed residues (ATOM records): (download)

>d1y9dd2 c.31.1.3 (D:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
yasapepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypakgi
vadrypaylgsanraaqkpanealaqadvvlfvgnnyntryflqididpaklgkrhktdi
avladaqktlaailaqvserestpwwqanlanvknwraylasled

SCOPe Domain Coordinates for d1y9dd2:

Click to download the PDB-style file with coordinates for d1y9dd2.
(The format of our PDB-style files is described here.)

Timeline for d1y9dd2: