![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
![]() | Protein automated matches [227126] (21 species) not a true protein |
![]() | Species Lactobacillus plantarum [TaxId:1590] [254973] (7 PDB entries) |
![]() | Domain d1y9dc3: 1y9d C:366-593 [240990] Other proteins in same PDB: d1y9da2, d1y9db2, d1y9dc2, d1y9dd2 automated match to d1powa3 complexed with fad, mg, na, so4, tpp |
PDB Entry: 1y9d (more details), 2.2 Å
SCOPe Domain Sequences for d1y9dc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y9dc3 c.36.1.0 (C:366-593) automated matches {Lactobacillus plantarum [TaxId: 1590]} kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqe dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd
Timeline for d1y9dc3: