Lineage for d1bzwb_ (1bzw B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371411Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (14 PDB entries)
  8. 371461Domain d1bzwb_: 1bzw B: [24099]

Details for d1bzwb_

PDB Entry: 1bzw (more details), 2.7 Å

PDB Description: peanut lectin complexed with c-lactose

SCOP Domain Sequences for d1bzwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzwb_ b.29.1.1 (B:) Legume lectin {Peanut (Arachis hypogaea)}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d1bzwb_:

Click to download the PDB-style file with coordinates for d1bzwb_.
(The format of our PDB-style files is described here.)

Timeline for d1bzwb_: