Lineage for d1y8fa_ (1y8f A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707113Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1707114Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 1707163Family g.49.1.0: automated matches [254207] (1 protein)
    not a true family
  6. 1707164Protein automated matches [254456] (2 species)
    not a true protein
  7. 1707169Species Norway rat (Rattus norvegicus) [TaxId:10116] [254972] (1 PDB entry)
  8. 1707170Domain d1y8fa_: 1y8f A: [240981]
    automated match to d1tbna_
    complexed with zn

Details for d1y8fa_

PDB Entry: 1y8f (more details)

PDB Description: solution structure of the munc13-1 c1-domain
PDB Compounds: (A:) unc-13 homolog a

SCOPe Domain Sequences for d1y8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8fa_ g.49.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qhnfevwtattptycyecegllwgiarqgmrctecgvkchekcqdllnadc

SCOPe Domain Coordinates for d1y8fa_:

Click to download the PDB-style file with coordinates for d1y8fa_.
(The format of our PDB-style files is described here.)

Timeline for d1y8fa_: