Lineage for d1y8fa1 (1y8f A:567-616)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588840Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 2588841Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 2588893Family g.49.1.0: automated matches [254207] (1 protein)
    not a true family
  6. 2588894Protein automated matches [254456] (2 species)
    not a true protein
  7. 2588899Species Norway rat (Rattus norvegicus) [TaxId:10116] [254972] (1 PDB entry)
  8. 2588900Domain d1y8fa1: 1y8f A:567-616 [240981]
    Other proteins in same PDB: d1y8fa2
    automated match to d1tbna_
    complexed with zn

Details for d1y8fa1

PDB Entry: 1y8f (more details)

PDB Description: Solution structure of the munc13-1 C1-domain
PDB Compounds: (A:) unc-13 homolog a

SCOPe Domain Sequences for d1y8fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8fa1 g.49.1.0 (A:567-616) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hnfevwtattptycyecegllwgiarqgmrctecgvkchekcqdllnadc

SCOPe Domain Coordinates for d1y8fa1:

Click to download the PDB-style file with coordinates for d1y8fa1.
(The format of our PDB-style files is described here.)

Timeline for d1y8fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y8fa2