SCOPe 2.08: Domain d1y8fa1: 1y8f A:567-616

Lineage for d1y8fa1 (1y8f A:567-616)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.49.1: Cysteine-rich domain [57889] (4 families)

5. Family g.49.1.0: automated matches [254207] (1 protein)
   not a true family

6. Protein automated matches [254456] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [254972] (3 PDB entries)

8. Domain d1y8fa1: 1y8f A:567-616 [240981]
   Other proteins in same PDB: d1y8fa2
   automated match to d1tbna_
   complexed with zn

Details for d1y8fa1

PDB Entry: 1y8f

PDB Description: solution structure of the munc13-1 c1-domain

PDB Compounds: (A:) unc-13 homolog a

SCOPe Domain Sequences for d1y8fa1:

Sequence; same for both SEQRES and ATOM records:

>d1y8fa1 g.49.1.0 (A:567-616) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hnfevwtattptycyecegllwgiarqgmrctecgvkchekcqdllnadc

Timeline for d1y8fa1:

• d1y8fa1 first appeared in SCOPe 2.04, called d1y8fa_
  
• d1y8fa1 appears in SCOPe 2.07