Lineage for d1y7wb_ (1y7w B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1556573Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1556574Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1557172Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 1557173Protein automated matches [191011] (7 species)
    not a true protein
  7. 1557174Species Dunaliella salina [TaxId:3046] [254971] (1 PDB entry)
  8. 1557176Domain d1y7wb_: 1y7w B: [240980]
    automated match to d1rj6b_
    complexed with acy, na, zn

Details for d1y7wb_

PDB Entry: 1y7w (more details), 1.86 Å

PDB Description: Crystal structure of a halotolerant carbonic anhydrase from Dunaliella salina
PDB Compounds: (B:) Halotolerant alpha-type carbonic anhydrase (dCA II)

SCOPe Domain Sequences for d1y7wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7wb_ b.74.1.0 (B:) automated matches {Dunaliella salina [TaxId: 3046]}
npndgydymqhgfdwpglqeggttkypacsgsnqspidintnqlmepssrsgtsavslng
lnvdgaqadgitltnakvdleqgmkvtfdqpaanlptieiggttksfvpiqfhfhhflse
htingihyplelhivmqeqdpadvataqlavigimykysengdaflnslqtqiegkigdg
tasygdtgvsidninvktqllpsslkyagydgslttpgcdervkwhvfttprevtreqmk
lfvdvtmgahagadvvnnrmiqdlgdrevykyny

SCOPe Domain Coordinates for d1y7wb_:

Click to download the PDB-style file with coordinates for d1y7wb_.
(The format of our PDB-style files is described here.)

Timeline for d1y7wb_: