Class b: All beta proteins [48724] (176 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (7 species) not a true protein |
Species Dunaliella salina [TaxId:3046] [254971] (1 PDB entry) |
Domain d1y7wb_: 1y7w B: [240980] automated match to d1rj6b_ complexed with acy, na, zn |
PDB Entry: 1y7w (more details), 1.86 Å
SCOPe Domain Sequences for d1y7wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7wb_ b.74.1.0 (B:) automated matches {Dunaliella salina [TaxId: 3046]} npndgydymqhgfdwpglqeggttkypacsgsnqspidintnqlmepssrsgtsavslng lnvdgaqadgitltnakvdleqgmkvtfdqpaanlptieiggttksfvpiqfhfhhflse htingihyplelhivmqeqdpadvataqlavigimykysengdaflnslqtqiegkigdg tasygdtgvsidninvktqllpsslkyagydgslttpgcdervkwhvfttprevtreqmk lfvdvtmgahagadvvnnrmiqdlgdrevykyny
Timeline for d1y7wb_: