SCOPe 2.06: Domain d1y3ka1: 1y3k A:1-73

Lineage for d1y3ka1 (1y3k A:1-73)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.0: automated matches [191590] (1 protein)
   not a true family

6. Protein automated matches [191063] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254969] (11 PDB entries)

8. Domain d1y3ka1: 1y3k A:1-73 [240978]
   Other proteins in same PDB: d1y3ka2
   automated match to d1kqka_

Details for d1y3ka1

PDB Entry: 1y3k

PDB Description: solution structure of the apo form of the fifth domain of menkes protein

PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d1y3ka1:

Sequence; same for both SEQRES and ATOM records:

>d1y3ka1 d.58.17.0 (A:1-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsskcyiqvtgmtcascvaniernlrreegiysilvalmagkaevrynpaviqppmiaef
irelgfgatvien

Timeline for d1y3ka1:

• d1y3ka1 first appeared in SCOPe 2.04, called d1y3ka_
  
• d1y3ka1 was called d1y3ka_ in SCOPe 2.05
  
• d1y3ka1 appears in SCOPe 2.07
  
• d1y3ka1 appears in the current release, SCOPe 2.08