Lineage for d1y3ka_ (1y3k A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653690Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1653813Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 1653814Protein automated matches [191063] (7 species)
    not a true protein
  7. 1653817Species Human (Homo sapiens) [TaxId:9606] [254969] (10 PDB entries)
  8. 1653829Domain d1y3ka_: 1y3k A: [240978]
    automated match to d1kqka_

Details for d1y3ka_

PDB Entry: 1y3k (more details)

PDB Description: Solution structure of the apo form of the fifth domain of Menkes protein
PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d1y3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y3ka_ d.58.17.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsskcyiqvtgmtcascvaniernlrreegiysilvalmagkaevrynpaviqppmiaef
irelgfgatvieniegr

SCOPe Domain Coordinates for d1y3ka_:

Click to download the PDB-style file with coordinates for d1y3ka_.
(The format of our PDB-style files is described here.)

Timeline for d1y3ka_: