Lineage for d1y3ka1 (1y3k A:1-73)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2954018Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 2954019Protein automated matches [191063] (9 species)
    not a true protein
  7. 2954025Species Human (Homo sapiens) [TaxId:9606] [254969] (13 PDB entries)
  8. 2954042Domain d1y3ka1: 1y3k A:1-73 [240978]
    Other proteins in same PDB: d1y3ka2
    automated match to d1kqka_

Details for d1y3ka1

PDB Entry: 1y3k (more details)

PDB Description: solution structure of the apo form of the fifth domain of menkes protein
PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d1y3ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y3ka1 d.58.17.0 (A:1-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsskcyiqvtgmtcascvaniernlrreegiysilvalmagkaevrynpaviqppmiaef
irelgfgatvien

SCOPe Domain Coordinates for d1y3ka1:

Click to download the PDB-style file with coordinates for d1y3ka1.
(The format of our PDB-style files is described here.)

Timeline for d1y3ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y3ka2