Lineage for d1y3ka1 (1y3k A:1-73)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. Protein automated matches [191063] (9 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [254969] (13 PDB entries)
  8. Domain d1y3ka1: 1y3k A:1-73 [240978]
    Other proteins in same PDB: d1y3ka2
    automated match to d1kqka_

Details for d1y3ka1

PDB Entry: 1y3k (more details)

PDB Description: Solution structure of the apo form of the fifth domain of Menkes protein
PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d1y3ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y3ka1 d.58.17.0 (A:1-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsskcyiqvtgmtcascvaniernlrreegiysilvalmagkaevrynpaviqppmiaef
irelgfgatvien

SCOPe Domain Coordinates for d1y3ka1 are not available.

Timeline for d1y3ka1:

Domains from same chain:
(mouse over for more information)
d1y3ka2