SCOPe 2.04: Domain d1y00b_: 1y00 B:

Lineage for d1y00b_ (1y00 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.151: CsrA-like [117129] (1 superfamily)
   sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)

4. Superfamily b.151.1: CsrA-like [117130] (1 family)

5. Family b.151.1.1: CsrA-like [117131] (2 proteins)
   Pfam PF02599

6. Protein Carbon storage regulator homolog, CsrA [117132] (2 species)

7. Species Escherichia coli [TaxId:562] [256387] (1 PDB entry)

8. Domain d1y00b_: 1y00 B: [240975]
   automated match to d2btia_

Details for d1y00b_

PDB Entry: 1y00

PDB Description: solution structure of the carbon storage regulator protein csra

PDB Compounds: (B:) Carbon storage regulator

SCOPe Domain Sequences for d1y00b_:

Sequence; same for both SEQRES and ATOM records:

>d1y00b_ b.151.1.1 (B:) Carbon storage regulator homolog, CsrA {Escherichia coli [TaxId: 562]}
mliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeksqqss
y

Timeline for d1y00b_:

• d1y00b_ is new in SCOPe 2.04-stable
  
• d1y00b_ appears in SCOPe 2.05
  
• d1y00b_ appears in the current release, SCOPe 2.08