Lineage for d1xzza1 (1xzz A:7-223)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2054099Superfamily b.42.6: MIR domain [82109] (3 families) (S)
  5. 2054107Family b.42.6.2: Ryanodine receptor N-terminal-like [254181] (3 protein domains)
    Pfam PF08709; members of this family have a helical insert between beta strands 4 and 5
  6. 2054108Protein IP3 receptor type 1 ligand binding suppressor domain [254404] (1 species)
  7. 2054109Species Mouse (Mus musculus) [TaxId:10090] [254840] (1 PDB entry)
  8. 2054110Domain d1xzza1: 1xzz A:7-223 [240973]
    Other proteins in same PDB: d1xzza2
    complexed with gol

Details for d1xzza1

PDB Entry: 1xzz (more details), 1.8 Å

PDB Description: Crystal structure of the ligand binding suppressor domain of type 1 inositol 1,4,5-trisphosphate receptor
PDB Compounds: (A:) Inositol 1,4,5-trisphosphate receptor type 1

SCOPe Domain Sequences for d1xzza1:

Sequence, based on SEQRES records: (download)

>d1xzza1 b.42.6.2 (A:7-223) IP3 receptor type 1 ligand binding suppressor domain {Mouse (Mus musculus) [TaxId: 10090]}
sflhigdicslyaegstngfistlglvddrcvvqpeagdlnnppkkfrdclfklcpmnry
saqkqfwkaakpgansttdavllnklhhaadlekkqnetenrkllgtviqygnviqllhl
ksnkyltvnkrlpalleknamrvtldeagnegswfyiqpfyklrsigdsvvigdkvvlnp
vnagqplhasshqlvdnpgcnevnsvncntswkivlf

Sequence, based on observed residues (ATOM records): (download)

>d1xzza1 b.42.6.2 (A:7-223) IP3 receptor type 1 ligand binding suppressor domain {Mouse (Mus musculus) [TaxId: 10090]}
sflhigdicslyaegstngfistlglvddrcvvqpeagdlnnppkkfrdclfklcpmnry
saqkqfwkasttdavllnklhhaadlekkqnetenrkllgtviqygnviqllhlksnkyl
tvnkrlpalleknamrvtldeagnegswfyiqpfyklrsigdsvvigdkvvlnpvnagqp
lhasshqlvdnpgcnevnsvncntswkivlf

SCOPe Domain Coordinates for d1xzza1:

Click to download the PDB-style file with coordinates for d1xzza1.
(The format of our PDB-style files is described here.)

Timeline for d1xzza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xzza2