Lineage for d1xx8a_ (1xx8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785034Family b.34.13.1: Histone-like proteins from archaea [54161] (2 proteins)
  6. 2785055Protein automated matches [190114] (2 species)
    not a true protein
  7. 2785056Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries)
  8. 2785072Domain d1xx8a_: 1xx8 A: [240972]
    automated match to d1azpa_
    mutant

Details for d1xx8a_

PDB Entry: 1xx8 (more details)

PDB Description: nmr structure of the w24a mutant of the hyperthermophile sac7d protein
PDB Compounds: (A:) sac7d

SCOPe Domain Sequences for d1xx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xx8a_ b.34.13.1 (A:) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]}
mvkvkfkykgeekevdtskikkvarvgkmvsftyddngktgrgavsekdapkelldmlar
aerekk

SCOPe Domain Coordinates for d1xx8a_:

Click to download the PDB-style file with coordinates for d1xx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1xx8a_: