Lineage for d1xwha_ (1xwh A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707171Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1707172Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 1707269Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 1707270Protein automated matches [190772] (3 species)
    not a true protein
  7. 1707273Species Human (Homo sapiens) [TaxId:9606] [187998] (19 PDB entries)
  8. 1707289Domain d1xwha_: 1xwh A: [240971]
    automated match to d2puyb_
    complexed with zn

Details for d1xwha_

PDB Entry: 1xwh (more details)

PDB Description: nmr structure of the first phd finger of autoimmune regulator protein (aire1): insights into apeced
PDB Compounds: (A:) Autoimmune regulator

SCOPe Domain Sequences for d1xwha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwha_ g.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamaqknedecavcrdggeliccdgcprafhlaclspplreipsgtwrcssclqatvqev
qpraee

SCOPe Domain Coordinates for d1xwha_:

Click to download the PDB-style file with coordinates for d1xwha_.
(The format of our PDB-style files is described here.)

Timeline for d1xwha_: