Lineage for d1xn1c_ (1xn1 C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1585842Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1585843Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 1585844Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 1585845Protein Lumazine synthase [52123] (7 species)
  7. 1585919Species Brucella abortus [TaxId:235] [52125] (2 PDB entries)
  8. 1585927Domain d1xn1c_: 1xn1 C: [240963]
    automated match to d1t13a_
    complexed with na, po4, so4

Details for d1xn1c_

PDB Entry: 1xn1 (more details), 3.05 Å

PDB Description: Crystal Structure Of Lumazine Synthase From Brucella Abortus (Orthorhombic Form At 3.05 Angstroms)
PDB Compounds: (C:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d1xn1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xn1c_ c.16.1.1 (C:) Lumazine synthase {Brucella abortus [TaxId: 235]}
tsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartg
ryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhdf
fhahfkvkgveaahaalqivsersria

SCOPe Domain Coordinates for d1xn1c_:

Click to download the PDB-style file with coordinates for d1xn1c_.
(The format of our PDB-style files is described here.)

Timeline for d1xn1c_: