Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (2 families) |
Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
Protein Lumazine synthase [52123] (7 species) |
Species Brucella abortus [TaxId:235] [52125] (2 PDB entries) |
Domain d1xn1a_: 1xn1 A: [240961] automated match to d1t13a_ complexed with na, po4, so4 |
PDB Entry: 1xn1 (more details), 3.05 Å
SCOPe Domain Sequences for d1xn1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xn1a_ c.16.1.1 (A:) Lumazine synthase {Brucella abortus [TaxId: 235]} tsfkiafiqarwhadivdearksfvaelaaktggsveveifdvpgayeiplhaktlartg ryaaivgaafvidggiyrhdfvatavingmmqvqletevpvlsvvltphhfheskehhdf fhahfkvkgveaahaalqivsersriaa
Timeline for d1xn1a_: