Lineage for d1xk5a_ (1xk5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2979301Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2979373Family d.142.2.5: m3G-cap binding domain of snurportin-1 [254171] (2 proteins)
  6. 2979374Protein m3G-cap binding domain of snurportin-1 [254388] (1 species)
  7. 2979375Species Human (Homo sapiens) [TaxId:9606] [254821] (2 PDB entries)
  8. 2979376Domain d1xk5a_: 1xk5 A: [240960]
    protein/RNA complex; complexed with tpg

Details for d1xk5a_

PDB Entry: 1xk5 (more details), 2.4 Å

PDB Description: Crystal structure of the m3G-cap-binding domain of snurportin1 in complex with a m3GpppG-cap dinucleotide
PDB Compounds: (A:) Snurportin-1

SCOPe Domain Sequences for d1xk5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xk5a_ d.142.2.5 (A:) m3G-cap binding domain of snurportin-1 {Human (Homo sapiens) [TaxId: 9606]}
hyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgstsaytksgycvnrfssll
pggnrrnstakdytildciynevnqtyyvldvmcwrghpfydcqtdfrfywmhsklpeee
glgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkqthyspgstplvgw
lrpymvsdvlgvavpagplttkpd

SCOPe Domain Coordinates for d1xk5a_:

Click to download the PDB-style file with coordinates for d1xk5a_.
(The format of our PDB-style files is described here.)

Timeline for d1xk5a_: