Lineage for d1xfra_ (1xfr A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. Protein automated matches [190345] (4 species)
    not a true protein
  7. Species Silkworm (Bombyx mori) [TaxId:7091] [187172] (3 PDB entries)
  8. Domain d1xfra_: 1xfr A: [240959]
    automated match to d1dqea_

Details for d1xfra_

PDB Entry: 1xfr (more details)

PDB Description: solution structure of the bombyx mori pheromone-binding protein fragment bmpbp(1-128) at ph 6.5
PDB Compounds: (A:) pheromone-binding protein

SCOPe Domain Sequences for d1xfra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfra_ a.39.2.1 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwa

SCOPe Domain Coordinates for d1xfra_ are not available.

Timeline for d1xfra_: