Lineage for d1x60a_ (1x60 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.52: Sporulation related repeat [110997] (2 families) (S)
    duplication: one domain contains two repeats of similar sequence and structure
    automatically mapped to Pfam PF05036
  5. Family d.58.52.0: automated matches [254205] (1 protein)
    not a true family
  6. Protein automated matches [254450] (1 species)
    not a true protein
  7. Species Bacillus subtilis [TaxId:1423] [254962] (1 PDB entry)
  8. Domain d1x60a_: 1x60 A: [240956]
    automated match to d1utaa_

Details for d1x60a_

PDB Entry: 1x60 (more details)

PDB Description: Solution structure of the peptidoglycan binding domain of B. subtilis cell wall lytic enzyme CwlC
PDB Compounds: (A:) Sporulation-specific N-acetylmuramoyl-L-alanine amidase

SCOPe Domain Sequences for d1x60a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x60a_ d.58.52.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
lkktsssglykvqigafkvkanadslasnaeakgfdsivllkdglykvqigafsskdnad
tlaaraknagfdaiviles

SCOPe Domain Coordinates for d1x60a_ are not available.

Timeline for d1x60a_: