SCOPe 2.05: Domain d1x5ba_: 1x5b A:

Lineage for d1x5ba_ (1x5b A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.0: automated matches [191620] (1 protein)
   not a true family

6. Protein automated matches [191137] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189251] (6 PDB entries)

8. Domain d1x5ba_: 1x5b A: [240953]
   automated match to d1elka_

Details for d1x5ba_

PDB Entry: 1x5b

PDB Description: the solution structure of the vhs domain of human signal transducing adaptor molecule 2

PDB Compounds: (A:) signal transducing adaptor molecule 2

SCOPe Domain Sequences for d1x5ba_:

Sequence; same for both SEQRES and ATOM records:

>d1x5ba_ a.118.9.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgmplftanpfeqdvekatneynttedwslimdicdkvgstpngakdclkaimkr
vnhkvphvalqaltllgacvancgkifhlevcsrdfatevraviknkahpkvceklkslm
vewseefqkdpqfslisatiksmkeegitfppagsqtsgpssg

Timeline for d1x5ba_:

• d1x5ba_ first appeared in SCOPe 2.04
  
• d1x5ba_ is called d1x5ba1 in SCOPe 2.06
  
• d1x5ba_ appears in the current release, SCOPe 2.08, called d1x5ba1