Lineage for d1x4ia1 (1x4i A:8-64)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642549Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2642550Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2642573Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 2642622Protein automated matches [190654] (2 species)
    not a true protein
  7. 2642623Species Human (Homo sapiens) [TaxId:9606] [188436] (5 PDB entries)
  8. 2642628Domain d1x4ia1: 1x4i A:8-64 [240952]
    Other proteins in same PDB: d1x4ia2, d1x4ia3
    automated match to d1wesa_
    complexed with zn

Details for d1x4ia1

PDB Entry: 1x4i (more details)

PDB Description: solution structure of phd domain in inhibitor of growth protein 3 (ing3)
PDB Compounds: (A:) Inhibitor of growth protein 3

SCOPe Domain Sequences for d1x4ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4ia1 g.50.1.2 (A:8-64) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ycicnqvsygemvgcdnqdcpiewfhygcvglteapkgkwycpqctaamkrrgsrhk

SCOPe Domain Coordinates for d1x4ia1:

Click to download the PDB-style file with coordinates for d1x4ia1.
(The format of our PDB-style files is described here.)

Timeline for d1x4ia1: