Class g: Small proteins [56992] (98 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.2: PHD domain [57911] (14 proteins) |
Protein automated matches [190654] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188436] (5 PDB entries) |
Domain d1x4ia1: 1x4i A:8-64 [240952] Other proteins in same PDB: d1x4ia2, d1x4ia3 automated match to d1wesa_ complexed with zn |
PDB Entry: 1x4i (more details)
SCOPe Domain Sequences for d1x4ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4ia1 g.50.1.2 (A:8-64) automated matches {Human (Homo sapiens) [TaxId: 9606]} ycicnqvsygemvgcdnqdcpiewfhygcvglteapkgkwycpqctaamkrrgsrhk
Timeline for d1x4ia1: