![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.2: PHD domain [57911] (14 proteins) |
![]() | Protein automated matches [190654] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188436] (5 PDB entries) |
![]() | Domain d1x4ia_: 1x4i A: [240952] automated match to d1wesa_ complexed with zn |
PDB Entry: 1x4i (more details)
SCOPe Domain Sequences for d1x4ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4ia_ g.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgycicnqvsygemvgcdnqdcpiewfhygcvglteapkgkwycpqctaamkrrg srhksgpssg
Timeline for d1x4ia_: