Lineage for d1x4ia_ (1x4i A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707171Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1707172Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 1707195Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 1707242Protein automated matches [190654] (2 species)
    not a true protein
  7. 1707243Species Human (Homo sapiens) [TaxId:9606] [188436] (5 PDB entries)
  8. 1707248Domain d1x4ia_: 1x4i A: [240952]
    automated match to d1wesa_
    complexed with zn

Details for d1x4ia_

PDB Entry: 1x4i (more details)

PDB Description: solution structure of phd domain in inhibitor of growth protein 3 (ing3)
PDB Compounds: (A:) Inhibitor of growth protein 3

SCOPe Domain Sequences for d1x4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4ia_ g.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgycicnqvsygemvgcdnqdcpiewfhygcvglteapkgkwycpqctaamkrrg
srhksgpssg

SCOPe Domain Coordinates for d1x4ia_:

Click to download the PDB-style file with coordinates for d1x4ia_.
(The format of our PDB-style files is described here.)

Timeline for d1x4ia_: