SCOPe 2.08: Domain d1x3ga_: 1x3g A:

Lineage for d1x3ga_ (1x3g A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
   barrel, closed; n=5, S=10

6. Protein automated matches [190206] (10 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:1772] [254961] (3 PDB entries)

8. Domain d1x3ga_: 1x3g A: [240949]
   automated match to d1ue1b_
   complexed with cd

Details for d1x3ga_

PDB Entry: 1x3g, 3 Å

PDB Description: crystal structure of the single-stranded dna-binding protein from mycobacterium smegmatis

PDB Compounds: (A:) Single-strand binding protein

SCOPe Domain Sequences for d1x3ga_:

Sequence, based on SEQRES records:

>d1x3ga_ b.40.4.3 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
gdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniwre
aaenvaesltrgsrvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnka

Sequence, based on observed residues (ATOM records):

>d1x3ga_ b.40.4.3 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
gdttitvvgnltadpelrftpsgaavanftvastprmfdrwkdgealflrcniwreaaen
vaesltrgsrvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnka

Timeline for d1x3ga_:

• d1x3ga_ first appeared in SCOPe 2.04
  
• d1x3ga_ appears in SCOPe 2.07