Lineage for d1x3fb_ (1x3f B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. Protein automated matches [190206] (10 species)
    not a true protein
  7. Species Mycobacterium smegmatis [TaxId:1772] [254961] (3 PDB entries)
  8. Domain d1x3fb_: 1x3f B: [240948]
    automated match to d1ue1b_
    complexed with cd

Details for d1x3fb_

PDB Entry: 1x3f (more details), 2.7 Å

PDB Description: crystal structure of the single-stranded dna-binding protein from mycobacterium smegmatis
PDB Compounds: (B:) Single-strand binding protein

SCOPe Domain Sequences for d1x3fb_:

Sequence, based on SEQRES records: (download)

>d1x3fb_ b.40.4.3 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
agdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniwr
eaaenvaesltrgsrvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnkas

Sequence, based on observed residues (ATOM records): (download)

>d1x3fb_ b.40.4.3 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
agdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniwr
eaaenvaesltrgsrvivtgrlkqrsfekrtvvevevdeigpslryatakvnkas

SCOPe Domain Coordinates for d1x3fb_ are not available.

Timeline for d1x3fb_:

Domains from other chains:
(mouse over for more information)
d1x3fa_