SCOPe 2.05: Domain d1x37a_: 1x37 A:

Lineage for d1x37a_ (1x37 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [230763] (2 PDB entries)

8. Domain d1x37a_: 1x37 A: [240944]
   automated match to d1qzma_

Details for d1x37a_

PDB Entry: 1x37

PDB Description: structure of bacillus subtilis lon protease ssd domain

PDB Compounds: (A:) ATP-dependent protease La 1

SCOPe Domain Sequences for d1x37a_:

Sequence; same for both SEQRES and ATOM records:

>d1x37a_ c.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
agyteiekleivkdhllpkqikehglkksnlqlrdqaildiiryytreagvrslerqlaa
icrkaakaivaeerkritvteknlqdfigkrifry

Timeline for d1x37a_:

• d1x37a_ first appeared in SCOPe 2.04
  
• d1x37a_ appears in SCOPe 2.06
  
• d1x37a_ appears in the current release, SCOPe 2.08