SCOPe 2.07: Domain d1x2qa1: 1x2q A:8-82

Lineage for d1x2qa1 (1x2q A:8-82)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)

8. Domain d1x2qa1: 1x2q A:8-82 [240943]
   Other proteins in same PDB: d1x2qa2, d1x2qa3
   automated match to d1j3ta_

Details for d1x2qa1

PDB Entry: 1x2q

PDB Description: solution structure of the sh3 domain of the signal transducing adaptor molecule 2

PDB Compounds: (A:) Signal transducing adapter molecule 2

SCOPe Domain Sequences for d1x2qa1:

Sequence; same for both SEQRES and ATOM records:

>d1x2qa1 b.34.2.0 (A:8-82) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seiqlnnkvarkvralydfeavedneltfkhgeiiivlddsdanwwkgenhrgiglfpsn
fvttnlnieteaaav

Timeline for d1x2qa1:

• d1x2qa1 first appeared in SCOPe 2.04, called d1x2qa_
  
• d1x2qa1 appears in SCOPe 2.06
  
• d1x2qa1 appears in the current release, SCOPe 2.08