Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries) |
Domain d1x2pa1: 1x2p A:8-62 [240942] Other proteins in same PDB: d1x2pa2, d1x2pa3 automated match to d1ue9a_ |
PDB Entry: 1x2p (more details)
SCOPe Domain Sequences for d1x2pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x2pa1 b.34.2.0 (A:8-62) automated matches {Human (Homo sapiens) [TaxId: 9606]} eefvaiadyaatdetqlsflrgekililrqttadwwwgeragccgyipanhvgkh
Timeline for d1x2pa1: