Lineage for d1x1qb_ (1x1q B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2480700Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2480954Protein automated matches [190054] (13 species)
    not a true protein
  7. 2481038Species Thermus thermophilus HB8 [TaxId:300852] [187272] (5 PDB entries)
  8. 2481047Domain d1x1qb_: 1x1q B: [240940]
    automated match to d1v8za1
    complexed with cl

Details for d1x1qb_

PDB Entry: 1x1q (more details), 2.5 Å

PDB Description: Crystal structure of tryptophan synthase beta chain from Thermus thermophilus HB8
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d1x1qb_:

Sequence, based on SEQRES records: (download)

>d1x1qb_ c.79.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ltlpdfplpdargrfgpyggryvpetlipaleeleaayreakkdpafleeldhylrqfag
rptplyhakrlseywggaqvflkredllhtgahkinntlgqallarrmgkrrviaetgag
qhgvsvatvaalfglecvvymgeedvrrqalnvfrmkllgaevrpvaagsrtlkdatnea
irdwitnvrttfyilgsvvgphpypmmvrdfqsvigeevkrqslelfgrlpdaliaavgg
gsnaiglfapfaylpegrpkligveaageglstgrhaasigagkrgvlhgsymyllydhd
gqitpahsvsagldypgvgpehsyyadagvaeyasvtdeealegfkllarlegiipales
ahaiayaakvvpemdkdqvvvinlsgrgdkdvtevmrllg

Sequence, based on observed residues (ATOM records): (download)

>d1x1qb_ c.79.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ltlpdfplpdargrfgpyggryvpetlipaleeleaayreakkdpafleeldhylrqfag
rptplyhakrlseywggaqvflkredllhtgahkinntlgqallarrmgkrrviaetgag
qhgvsvatvaalfglecvvymgeedvrrqalnvfrmkllgaevrptlkdatneairdwit
nvrttfyilgsvvgphpypmmvrdfqsvigeevkrqslelfgrlpdaliaavgggsnaig
lfapfaylpegrpkligveaasvsagldypgvgpehsyyadagvaeyasvtdeealegfk
llarlegiipalesahaiayaakvvpemdkdqvvvinlsgrgdkdvtevmrllg

SCOPe Domain Coordinates for d1x1qb_:

Click to download the PDB-style file with coordinates for d1x1qb_.
(The format of our PDB-style files is described here.)

Timeline for d1x1qb_: