Lineage for d1x0oa1 (1x0o A:5-119)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2534777Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2535027Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2535028Protein automated matches [190492] (24 species)
    not a true protein
  7. 2535063Species Human (Homo sapiens) [TaxId:9606] [187434] (30 PDB entries)
  8. 2535089Domain d1x0oa1: 1x0o A:5-119 [240938]
    Other proteins in same PDB: d1x0oa2
    automated match to d3h82b_

Details for d1x0oa1

PDB Entry: 1x0o (more details)

PDB Description: human ARNT C-terminal PAS domain
PDB Compounds: (A:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d1x0oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0oa1 d.110.3.0 (A:5-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvcqptefisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqv
vklkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvknssqe

SCOPe Domain Coordinates for d1x0oa1:

Click to download the PDB-style file with coordinates for d1x0oa1.
(The format of our PDB-style files is described here.)

Timeline for d1x0oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x0oa2