| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
Superfamily a.21.1: HMG-box [47095] (2 families) ![]() |
| Family a.21.1.0: automated matches [191668] (1 protein) not a true family |
| Protein automated matches [191268] (4 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [254956] (2 PDB entries) |
| Domain d1wz6a_: 1wz6 A: [240937] automated match to d2lefa_ |
PDB Entry: 1wz6 (more details)
SCOPe Domain Sequences for d1wz6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wz6a_ a.21.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgarrpmnafllfckrhrslvrqehprldnrgatkiladwwavldpkekqkytdm
akeykdafmkanpgyrsgpssg
Timeline for d1wz6a_: