![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.21.1: HMG-box [47095] (2 families) ![]() |
![]() | Family a.21.1.0: automated matches [191668] (1 protein) not a true family |
![]() | Protein automated matches [191268] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [254956] (2 PDB entries) |
![]() | Domain d1wz6a1: 1wz6 A:8-76 [240937] Other proteins in same PDB: d1wz6a2, d1wz6a3 automated match to d2lefa_ |
PDB Entry: 1wz6 (more details)
SCOPe Domain Sequences for d1wz6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wz6a1 a.21.1.0 (A:8-76) automated matches {Mouse (Mus musculus) [TaxId: 10090]} arrpmnafllfckrhrslvrqehprldnrgatkiladwwavldpkekqkytdmakeykda fmkanpgyr
Timeline for d1wz6a1: