SCOPe 2.08: Domain d1wz6a1: 1wz6 A:8-76

Lineage for d1wz6a1 (1wz6 A:8-76)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.0: automated matches [191668] (1 protein)
   not a true family

6. Protein automated matches [191268] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [254956] (2 PDB entries)

8. Domain d1wz6a1: 1wz6 A:8-76 [240937]
   Other proteins in same PDB: d1wz6a2, d1wz6a3
   automated match to d2lefa_

Details for d1wz6a1

PDB Entry: 1wz6

PDB Description: solution structure of the hmg_box domain of murine bobby sox homolog

PDB Compounds: (A:) HMG-BOX transcription factor BBX

SCOPe Domain Sequences for d1wz6a1:

Sequence; same for both SEQRES and ATOM records:

>d1wz6a1 a.21.1.0 (A:8-76) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
arrpmnafllfckrhrslvrqehprldnrgatkiladwwavldpkekqkytdmakeykda
fmkanpgyr

Timeline for d1wz6a1:

• d1wz6a1 first appeared in SCOPe 2.04, called d1wz6a_
  
• d1wz6a1 appears in SCOPe 2.07