Lineage for d1wz6a1 (1wz6 A:8-76)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2698036Family a.21.1.0: automated matches [191668] (1 protein)
    not a true family
  6. 2698037Protein automated matches [191268] (4 species)
    not a true protein
  7. 2698049Species Mouse (Mus musculus) [TaxId:10090] [254956] (2 PDB entries)
  8. 2698051Domain d1wz6a1: 1wz6 A:8-76 [240937]
    Other proteins in same PDB: d1wz6a2, d1wz6a3
    automated match to d2lefa_

Details for d1wz6a1

PDB Entry: 1wz6 (more details)

PDB Description: solution structure of the hmg_box domain of murine bobby sox homolog
PDB Compounds: (A:) HMG-BOX transcription factor BBX

SCOPe Domain Sequences for d1wz6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wz6a1 a.21.1.0 (A:8-76) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
arrpmnafllfckrhrslvrqehprldnrgatkiladwwavldpkekqkytdmakeykda
fmkanpgyr

SCOPe Domain Coordinates for d1wz6a1:

Click to download the PDB-style file with coordinates for d1wz6a1.
(The format of our PDB-style files is described here.)

Timeline for d1wz6a1: