SCOPe 2.08: Domain d1wyra1: 1wyr A:8-115

Lineage for d1wyra1 (1wyr A:8-115)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)

8. Domain d1wyra1: 1wyr A:8-115 [240935]
   Other proteins in same PDB: d1wyra2, d1wyra3
   automated match to d1ujoa_

Details for d1wyra1

PDB Entry: 1wyr

PDB Description: solution structure of the ch domain of human rho guanine nucleotide exchange factor 6

PDB Compounds: (A:) Rho guanine nucleotide exchange factor 6

SCOPe Domain Sequences for d1wyra1:

Sequence; same for both SEQRES and ATOM records:

>d1wyra1 a.40.1.0 (A:8-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeqivtwlislgvlespkkticdpeeflksslkngvvlcklinrlmpgsvekfcldpqte
adcinnindflkgcatlqveifdpddlysgvnfskvlstllavnkate

Timeline for d1wyra1:

• d1wyra1 first appeared in SCOPe 2.04, called d1wyra_
  
• d1wyra1 appears in SCOPe 2.07